Lineage for d3r9pa2 (3r9p A:187-387)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138832Species Mycobacterium avium [TaxId:1770] [226122] (1 PDB entry)
  8. 2138834Domain d3r9pa2: 3r9p A:187-387 [215676]
    automated match to d1g99a2
    complexed with edo, gol, pge

Details for d3r9pa2

PDB Entry: 3r9p (more details), 1.9 Å

PDB Description: crystal structure of acka from mycobacterium paratuberculosis atcc baa-968 / k-10
PDB Compounds: (A:) AckA

SCOPe Domain Sequences for d3r9pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r9pa2 c.55.1.0 (A:187-387) automated matches {Mycobacterium avium [TaxId: 1770]}
plrglkqivlhlgngcsasaiagtrpldtsmgltpleglvmgtrsgdidpsivsylchta
gmgvddvesmlnhrsgvvglsgvrdfrrlreliesgdgaaqlaysvfthrlrkyigayla
vlghtdvisftagigendaavrrdavsgmeelgivlderrnlaggkgarqisaddspitv
lvvptneelaiardcvrvlgg

SCOPe Domain Coordinates for d3r9pa2:

Click to download the PDB-style file with coordinates for d3r9pa2.
(The format of our PDB-style files is described here.)

Timeline for d3r9pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r9pa1