Lineage for d3qtyb1 (3qty B:18-170)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658121Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1658193Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 1658194Protein automated matches [226901] (6 species)
    not a true protein
  7. 1658201Species Francisella tularensis [TaxId:119856] [226090] (1 PDB entry)
  8. 1658203Domain d3qtyb1: 3qty B:18-170 [215417]
    Other proteins in same PDB: d3qtya2, d3qtyb2
    automated match to d1clia1
    complexed with fmt, po4, pop, so4, trs

Details for d3qtyb1

PDB Entry: 3qty (more details), 1.8 Å

PDB Description: Crystal structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis complexed with pyrophosphate
PDB Compounds: (B:) Phosphoribosylaminoimidazol (AIR) synthetase

SCOPe Domain Sequences for d3qtyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qtyb1 d.79.4.0 (B:18-170) automated matches {Francisella tularensis [TaxId: 119856]}
qavermkqhvkktftqdvltglgsfgslyslkniinnyddpvlvqsidgvgtktkvavmc
gkfenlgydlfsaatndivvmgakpitfldyvahdkldpaimeelvkgmskacaecgvsl
vggetaempgvyqageidmvgvitgivdrkrii

SCOPe Domain Coordinates for d3qtyb1:

Click to download the PDB-style file with coordinates for d3qtyb1.
(The format of our PDB-style files is described here.)

Timeline for d3qtyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qtyb2