| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) ![]() |
| Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
| Protein automated matches [226902] (7 species) not a true protein |
| Species Francisella tularensis [TaxId:119856] [226091] (1 PDB entry) |
| Domain d3qtya2: 3qty A:171-347 [215416] Other proteins in same PDB: d3qtya1, d3qtyb1 automated match to d1clia2 complexed with fmt, po4, pop, so4, trs |
PDB Entry: 3qty (more details), 1.8 Å
SCOPe Domain Sequences for d3qtya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qtya2 d.139.1.0 (A:171-347) automated matches {Francisella tularensis [TaxId: 119856]}
ngenikegdivfglsssglhtngysfarklffdvagnkhtdtypelegktigdvllephi
nytniihdfldngvdikgmahitgggfieniprvlpqglgaqidkdsfatpaifklmqri
gdisefemyrsfnmgigmtiiasqdqfdkmqelakkhtntklyqigkitnsgkveii
Timeline for d3qtya2: