SCOPe 2.04: Domain d3qtya2: 3qty A:171-347

Lineage for d3qtya2 (3qty A:171-347)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (7 species)
   not a true protein

7. Species Francisella tularensis [TaxId:119856] [226091] (1 PDB entry)

8. Domain d3qtya2: 3qty A:171-347 [215416]
   Other proteins in same PDB: d3qtya1, d3qtyb1
   automated match to d1clia2
   complexed with fmt, po4, pop, so4, trs

Details for d3qtya2

PDB Entry: 3qty, 1.8 Å

PDB Description: Crystal structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis complexed with pyrophosphate

PDB Compounds: (A:) Phosphoribosylaminoimidazol (AIR) synthetase

SCOPe Domain Sequences for d3qtya2:

Sequence; same for both SEQRES and ATOM records:

>d3qtya2 d.139.1.0 (A:171-347) automated matches {Francisella tularensis [TaxId: 119856]}
ngenikegdivfglsssglhtngysfarklffdvagnkhtdtypelegktigdvllephi
nytniihdfldngvdikgmahitgggfieniprvlpqglgaqidkdsfatpaifklmqri
gdisefemyrsfnmgigmtiiasqdqfdkmqelakkhtntklyqigkitnsgkveii

Timeline for d3qtya2:

• d3qtya2 first appeared in SCOPe 2.03
  
• d3qtya2 appears in SCOPe 2.05
  
• d3qtya2 appears in the current release, SCOPe 2.08