Lineage for d3qn3c2 (3qn3 C:137-414)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1573934Species Campylobacter jejuni [TaxId:197] [226083] (1 PDB entry)
  8. 1573937Domain d3qn3c2: 3qn3 C:137-414 [215305]
    Other proteins in same PDB: d3qn3a1, d3qn3b1, d3qn3c1, d3qn3d1
    automated match to d1w6ta1
    complexed with gol, mg, mpd, so4

Details for d3qn3c2

PDB Entry: 3qn3 (more details), 2.13 Å

PDB Description: phosphopyruvate hydratase from campylobacter jejuni.
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d3qn3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qn3c2 c.1.11.0 (C:137-414) automated matches {Campylobacter jejuni [TaxId: 197]}
nasilpvpmcniinggahannnvdfqefmimpfgftsfkealrsvceiyailkkelansg
hstalgdeggfapnlanntepidllmtcikkagyenrvkialdvasteffkdgkyhmegk
afssealieryvelcakypicsiedglaendfegwiklteklgnkiqlvgddlfvtnedi
lregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvmshrsgesedafiadfava
lntgqiktgalargertakynrlleiefesdeylgekl

SCOPe Domain Coordinates for d3qn3c2:

Click to download the PDB-style file with coordinates for d3qn3c2.
(The format of our PDB-style files is described here.)

Timeline for d3qn3c2: