| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (71 species) not a true protein |
| Species Campylobacter jejuni [TaxId:197] [226083] (1 PDB entry) |
| Domain d3qn3c2: 3qn3 C:137-414 [215305] Other proteins in same PDB: d3qn3a1, d3qn3b1, d3qn3c1, d3qn3d1 automated match to d1w6ta1 complexed with gol, mg, mpd, so4 |
PDB Entry: 3qn3 (more details), 2.13 Å
SCOPe Domain Sequences for d3qn3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qn3c2 c.1.11.0 (C:137-414) automated matches {Campylobacter jejuni [TaxId: 197]}
nasilpvpmcniinggahannnvdfqefmimpfgftsfkealrsvceiyailkkelansg
hstalgdeggfapnlanntepidllmtcikkagyenrvkialdvasteffkdgkyhmegk
afssealieryvelcakypicsiedglaendfegwiklteklgnkiqlvgddlfvtnedi
lregiikkmanavlikpnqigtitqtmrtvrlaqrnnykcvmshrsgesedafiadfava
lntgqiktgalargertakynrlleiefesdeylgekl
Timeline for d3qn3c2: