![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
![]() | Domain d1e4kb1: 1e4k B:229-341 [21528] Other proteins in same PDB: d1e4ka2, d1e4kb2, d1e4kc1, d1e4kc2 part of a Fc |
PDB Entry: 1e4k (more details), 3.2 Å
SCOPe Domain Sequences for d1e4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4kb1 b.1.1.2 (B:229-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} cpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnak tkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg
Timeline for d1e4kb1:
![]() Domains from other chains: (mouse over for more information) d1e4ka1, d1e4ka2, d1e4kc1, d1e4kc2 |