Lineage for d1e4kc1 (1e4k C:1-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753603Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753612Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
    Uniprot O75015 23-189
  8. 2753633Domain d1e4kc1: 1e4k C:1-86 [21787]
    Other proteins in same PDB: d1e4ka1, d1e4ka2, d1e4kb1, d1e4kb2

Details for d1e4kc1

PDB Entry: 1e4k (more details), 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex
PDB Compounds: (C:) low affinity immunoglobulin gamma fc receptor III

SCOPe Domain Sequences for d1e4kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4kc1 b.1.1.4 (C:1-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
dlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatv
ndsgeyrcqtnlstlsdpvqlevhig

SCOPe Domain Coordinates for d1e4kc1:

Click to download the PDB-style file with coordinates for d1e4kc1.
(The format of our PDB-style files is described here.)

Timeline for d1e4kc1: