SCOPe 2.08: Domain d1e4ka2: 1e4k A:342-444

Lineage for d1e4ka2 (1e4k A:342-444)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d1e4ka2: 1e4k A:342-444 [21527]
   Other proteins in same PDB: d1e4ka1, d1e4kb1, d1e4kc1, d1e4kc2
   part of a Fc

Details for d1e4ka2

PDB Entry: 1e4k, 3.2 Å

PDB Description: crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex

PDB Compounds: (A:) fc fragment of human igg1

SCOPe Domain Sequences for d1e4ka2:

Sequence; same for both SEQRES and ATOM records:

>d1e4ka2 b.1.1.2 (A:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d1e4ka2:

• d1e4ka2 first appeared (with stable ids) in SCOP 1.55
  
• d1e4ka2 appears in SCOPe 2.07