Lineage for d3pwza1 (3pwz A:2-101)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143051Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2143052Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2143365Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2143366Protein automated matches [226864] (29 species)
    not a true protein
  7. 2143515Species Pseudomonas putida [TaxId:303] [226208] (1 PDB entry)
  8. 2143516Domain d3pwza1: 3pwz A:2-101 [214962]
    Other proteins in same PDB: d3pwza2
    automated match to d1p77a2

Details for d3pwza1

PDB Entry: 3pwz (more details), 1.71 Å

PDB Description: crystal structure of an ael1 enzyme from pseudomonas putida
PDB Compounds: (A:) Shikimate dehydrogenase 3

SCOPe Domain Sequences for d3pwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwza1 c.58.1.0 (A:2-101) automated matches {Pseudomonas putida [TaxId: 303]}
sdryavigrpinhtksplihglfaqasnqqleygaiegslddfeaqvlqfrseggkgmni
tapfklrafeladrrseraqlaraanalkfedgrivaenf

SCOPe Domain Coordinates for d3pwza1:

Click to download the PDB-style file with coordinates for d3pwza1.
(The format of our PDB-style files is described here.)

Timeline for d3pwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pwza2