Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (29 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [226208] (1 PDB entry) |
Domain d3pwza1: 3pwz A:2-101 [214962] Other proteins in same PDB: d3pwza2 automated match to d1p77a2 |
PDB Entry: 3pwz (more details), 1.71 Å
SCOPe Domain Sequences for d3pwza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwza1 c.58.1.0 (A:2-101) automated matches {Pseudomonas putida [TaxId: 303]} sdryavigrpinhtksplihglfaqasnqqleygaiegslddfeaqvlqfrseggkgmni tapfklrafeladrrseraqlaraanalkfedgrivaenf
Timeline for d3pwza1: