PDB entry 3pwz

View 3pwz on RCSB PDB site
Description: Crystal structure of an Ael1 enzyme from Pseudomonas putida
Class: oxidoreductase
Keywords: alpha-beta, shikimate dehydrogenase,enzyme, OXIDOREDUCTASE
Deposited on 2010-12-09, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.214
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate dehydrogenase 3
    Species: Pseudomonas putida [TaxId:303]
    Gene: Ael1, aroE-2, aroE3, PP3002, PP_3002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pwza1, d3pwza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pwzA (A:)
    msdryavigrpinhtksplihglfaqasnqqleygaiegslddfeaqvlqfrseggkgmn
    itapfklrafeladrrseraqlaraanalkfedgrivaenfdgigllrdieenlgeplrn
    rrvlllgaggavrgallpflqagpselvianrdmakalalrneldhsrlrisryealegq
    sfdivvnatsasltadlpplpadvlgeaalayelaygkgltpflrlareqgqarladgvg
    mlveqaaeafawwrgvrpdtravinqltiple
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pwzA (A:)
    sdryavigrpinhtksplihglfaqasnqqleygaiegslddfeaqvlqfrseggkgmni
    tapfklrafeladrrseraqlaraanalkfedgrivaenfdgigllrdieenlgeplrnr
    rvlllgaggavrgallpflqagpselvianrdmakalalrneldhsrlrisryealegqs
    fdivvnatsasltadlpplpadvlgeaalayelaygkgltpflrlareqgqarladgvgm
    lveqaaeafawwrgvrpdtravinqltiple