SCOPe 2.06: Domain d3pqfd1: 3pqf D:3-147

Lineage for d3pqfd1 (3pqf D:3-147)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)

8. Domain d3pqfd1: 3pqf D:3-147 [214931]
   Other proteins in same PDB: d3pqfa2, d3pqfb2, d3pqfc2, d3pqfd2
   automated match to d1llca1
   complexed with nad; mutant

Details for d3pqfd1

PDB Entry: 3pqf, 2.49 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis mutation H171C complexed with NAD+

PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqfd1:

Sequence; same for both SEQRES and ATOM records:

>d3pqfd1 c.2.1.0 (D:3-147) automated matches {Bacillus subtilis [TaxId: 1423]}
khvnkvaligagfvgssyafalinqgitdelvvidvnkekamgdvmdlnhgkafapqpvk
tsygtyedckdadivcicaganqkpgetrlelveknlkifkgivsevmasgfdgiflvat
npvdiltyatwkfsglpkervigsg

Timeline for d3pqfd1:

• d3pqfd1 first appeared in SCOPe 2.03
  
• d3pqfd1 appears in SCOPe 2.05
  
• d3pqfd1 appears in SCOPe 2.07
  
• d3pqfd1 appears in the current release, SCOPe 2.08