Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (29 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries) |
Domain d3pqfb2: 3pqf B:148-315 [214928] Other proteins in same PDB: d3pqfa1, d3pqfb1, d3pqfc1, d3pqfd1 automated match to d1llca2 complexed with nad; mutant |
PDB Entry: 3pqf (more details), 2.49 Å
SCOPe Domain Sequences for d3pqfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pqfb2 d.162.1.0 (B:148-315) automated matches {Bacillus subtilis [TaxId: 1423]} ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphfa
Timeline for d3pqfb2: