Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (29 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries) |
Domain d3pqed2: 3pqe D:148-314 [214924] Other proteins in same PDB: d3pqea1, d3pqeb1, d3pqec1, d3pqed1 automated match to d1llca2 mutant |
PDB Entry: 3pqe (more details), 2.2 Å
SCOPe Domain Sequences for d3pqed2:
Sequence, based on SEQRES records: (download)
>d3pqed2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]} ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf
>d3pqed2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]} ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndykq eeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqygad dvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf
Timeline for d3pqed2: