Lineage for d3pqed2 (3pqe D:148-314)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939281Species Bacillus subtilis [TaxId:1423] [226266] (3 PDB entries)
  8. 1939297Domain d3pqed2: 3pqe D:148-314 [214924]
    Other proteins in same PDB: d3pqea1, d3pqeb1, d3pqec1, d3pqed1
    automated match to d1llca2
    mutant

Details for d3pqed2

PDB Entry: 3pqe (more details), 2.2 Å

PDB Description: Crystal structure of L-lactate dehydrogenase from Bacillus subtilis with H171C mutation
PDB Compounds: (D:) l-lactate dehydrogenase

SCOPe Domain Sequences for d3pqed2:

Sequence, based on SEQRES records: (download)

>d3pqed2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndayk
qeeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqyga
ddvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf

Sequence, based on observed residues (ATOM records): (download)

>d3pqed2 d.162.1.0 (D:148-314) automated matches {Bacillus subtilis [TaxId: 1423]}
ttldsarfrfmlseyfgaapqnvcahiigehgdtelpvwshanvggvpvselvekndykq
eeldqivddvknaayhiiekkgatyygvamslaritkailhnensiltvstyldgqygad
dvyigvpavvnrggiagitelnlnekekeqflhsagvlknilkphf

SCOPe Domain Coordinates for d3pqed2:

Click to download the PDB-style file with coordinates for d3pqed2.
(The format of our PDB-style files is described here.)

Timeline for d3pqed2: