SCOPe 2.04: Domain d3pmsa1: 3pms A:4-140

Lineage for d3pmsa1 (3pms A:4-140)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.1: PHM/PNGase F [49742] (2 families)
   members of this superfamily bind peptide substrates
   duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits

5. Family b.121.1.1: Glycosyl-asparaginase [49743] (2 proteins)

6. Protein automated matches [227056] (1 species)
   not a true protein

7. Species Elizabethkingia meningoseptica [TaxId:238] [226062] (1 PDB entry)

8. Domain d3pmsa1: 3pms A:4-140 [214872]
   automated match to d1pnfa1
   complexed with act, gol, so4

Details for d3pmsa1

PDB Entry: 3pms, 1.57 Å

PDB Description: Recombinant peptide: N-glycanase F (PNGase F)

PDB Compounds: (A:) Peptide:N-glycosidase F

SCOPe Domain Sequences for d3pmsa1:

Sequence; same for both SEQRES and ATOM records:

>d3pmsa1 b.121.1.1 (A:4-140) automated matches {Elizabethkingia meningoseptica [TaxId: 238]}
dntvniktfdkvknafgdglsqsaegtftfpadvtavktikmfiknecpnktcdewdrya
nvyvknkttgewyeigrfitpywvgteklprgleidvtdfksllsgntelkiytetwlak
greysvdfdivygtpdy

Timeline for d3pmsa1:

• d3pmsa1 first appeared in SCOPe 2.03
  
• d3pmsa1 appears in SCOPe 2.05
  
• d3pmsa1 appears in the current release, SCOPe 2.08