| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.0: automated matches [194949] (1 protein) not a true family |
| Protein automated matches [194950] (3 species) not a true protein |
| Species Zebrafish (Danio rerio) [TaxId:7955] [226175] (1 PDB entry) |
| Domain d3piwa_: 3piw A: [214806] automated match to d3ux9c_ |
PDB Entry: 3piw (more details), 1.49 Å
SCOPe Domain Sequences for d3piwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3piwa_ a.26.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
cimrrkhvktaysllesmggifpreclkenvritfpkyalqsnnsnqktgvakavykimd
hidvlfandsypeawnkrkvdnfqnivyrltkenkcimrmraqgtvddfparddalksyf
nklatllrnkdnsfcawevvrhellgvlsdiiqp
Timeline for d3piwa_: