Lineage for d3piwa_ (3piw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705910Family a.26.1.0: automated matches [194949] (1 protein)
    not a true family
  6. 2705911Protein automated matches [194950] (3 species)
    not a true protein
  7. 2705918Species Zebrafish (Danio rerio) [TaxId:7955] [226175] (1 PDB entry)
  8. 2705919Domain d3piwa_: 3piw A: [214806]
    automated match to d3ux9c_

Details for d3piwa_

PDB Entry: 3piw (more details), 1.49 Å

PDB Description: zebrafish interferon 2
PDB Compounds: (A:) Type I interferon 2

SCOPe Domain Sequences for d3piwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3piwa_ a.26.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
cimrrkhvktaysllesmggifpreclkenvritfpkyalqsnnsnqktgvakavykimd
hidvlfandsypeawnkrkvdnfqnivyrltkenkcimrmraqgtvddfparddalksyf
nklatllrnkdnsfcawevvrhellgvlsdiiqp

SCOPe Domain Coordinates for d3piwa_:

Click to download the PDB-style file with coordinates for d3piwa_.
(The format of our PDB-style files is described here.)

Timeline for d3piwa_: