SCOPe 2.08: Domain d3p3ca1: 3p3c A:2-127

Lineage for d3p3ca1 (3p3c A:2-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein automated matches [226920] (2 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [226049] (2 PDB entries)

8. Domain d3p3ca1: 3p3c A:2-127 [214638]
   automated match to d2go3a1
   complexed with 3p3, po4, zn

Details for d3p3ca1

PDB Entry: 3p3c, 1.25 Å

PDB Description: crystal structure of the aquifex aeolicus lpxc/lpc-009 complex

PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d3p3ca1:

Sequence; same for both SEQRES and ATOM records:

>d3p3ca1 d.14.1.7 (A:2-127) automated matches {Aquifex aeolicus [TaxId: 63363]}
glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
dyfvve

Timeline for d3p3ca1:

• d3p3ca1 first appeared in SCOPe 2.03
  
• d3p3ca1 appears in SCOPe 2.07