Lineage for d3p3ca1 (3p3c A:2-127)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401906Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
    duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site
  6. 1401945Protein automated matches [226920] (2 species)
    not a true protein
  7. 1401951Species Aquifex aeolicus [TaxId:63363] [226049] (2 PDB entries)
  8. 1401952Domain d3p3ca1: 3p3c A:2-127 [214638]
    automated match to d2go3a1
    complexed with 3p3, po4, zn

Details for d3p3ca1

PDB Entry: 3p3c (more details), 1.25 Å

PDB Description: crystal structure of the aquifex aeolicus lpxc/lpc-009 complex
PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d3p3ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p3ca1 d.14.1.7 (A:2-127) automated matches {Aquifex aeolicus [TaxId: 63363]}
glektvkeklsfegvgihtgeyskliihpekegtgirffkngvyiparhefvvhtnhstd
lgfkgqriktvehilsvlhlleitnvtievigneipildgsgwefyeairknilnqnrei
dyfvve

SCOPe Domain Coordinates for d3p3ca1:

Click to download the PDB-style file with coordinates for d3p3ca1.
(The format of our PDB-style files is described here.)

Timeline for d3p3ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p3ca2