Lineage for d3otrd2 (3otr D:148-446)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1574284Species Toxoplasma gondii [TaxId:508771] [225975] (1 PDB entry)
  8. 1574288Domain d3otrd2: 3otr D:148-446 [214548]
    Other proteins in same PDB: d3otra1, d3otrb1, d3otrc1, d3otrd1, d3otre1, d3otrf1
    automated match to d1pdza1
    complexed with cl, so4

Details for d3otrd2

PDB Entry: 3otr (more details), 2.75 Å

PDB Description: 2.75 angstrom crystal structure of enolase 1 from toxoplasma gondii
PDB Compounds: (D:) enolase

SCOPe Domain Sequences for d3otrd2:

Sequence, based on SEQRES records: (download)

>d3otrd2 c.1.11.0 (D:148-446) automated matches {Toxoplasma gondii [TaxId: 508771]}
dkmvmpvpffnvinggehagnglalqefliapvgapnireairygsetyhhlknviknky
gldatnvgdeggfapnvataeealnllveaikaagyegkikiafdaaasefykqdekkyd
ldykcktknaskhltgeklkevyegwlkkypiisvedpfdqddfasfsaftkdvgektqv
igddilvtnilriekalkdkacnclllkvnqigsvteaieacllaqksgwgvqvshrsge
tedsfiadlvvglrcgqiksgspcrserlckynqlmrieeslgadcvyagesfrhpkrs

Sequence, based on observed residues (ATOM records): (download)

>d3otrd2 c.1.11.0 (D:148-446) automated matches {Toxoplasma gondii [TaxId: 508771]}
dkmvmpvpffnvinggehagnglalqefliapvgapnireairygsetyhhlknviknky
gldatnvgdeggfapnvataeealnllveaikaagyegkikiafdaaasefykqdekkyd
ldykckhltgeklkevyegwlkkypiisvedpfdqddfasfsaftkdvgektqvigddil
vtnilriekalkdkacnclllkvnqigsvteaieacllaqksgwgvqvshrsgetedsfi
adlvvglrcgqiksgspcrserlckynqlmrieeslgadcvyagesfrhpkrs

SCOPe Domain Coordinates for d3otrd2:

Click to download the PDB-style file with coordinates for d3otrd2.
(The format of our PDB-style files is described here.)

Timeline for d3otrd2: