| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Toxoplasma gondii [TaxId:508771] [225974] (1 PDB entry) |
| Domain d3otra1: 3otr A:1-147 [214541] Other proteins in same PDB: d3otra2, d3otrb2, d3otrc2, d3otrd2, d3otre2, d3otrf2 automated match to d1pdza2 complexed with cl, so4 |
PDB Entry: 3otr (more details), 2.75 Å
SCOPe Domain Sequences for d3otra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3otra1 d.54.1.0 (A:1-147) automated matches {Toxoplasma gondii [TaxId: 508771]}
mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
iaccragaaskglplykyiatlagkti
Timeline for d3otra1: