Lineage for d3otra1 (3otr A:1-147)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649780Species Toxoplasma gondii [TaxId:508771] [225974] (1 PDB entry)
  8. 1649781Domain d3otra1: 3otr A:1-147 [214541]
    Other proteins in same PDB: d3otra2, d3otrb2, d3otrc2, d3otrd2, d3otre2, d3otrf2
    automated match to d1pdza2
    complexed with cl, so4

Details for d3otra1

PDB Entry: 3otr (more details), 2.75 Å

PDB Description: 2.75 angstrom crystal structure of enolase 1 from toxoplasma gondii
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d3otra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3otra1 d.54.1.0 (A:1-147) automated matches {Toxoplasma gondii [TaxId: 508771]}
mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
iaccragaaskglplykyiatlagkti

SCOPe Domain Coordinates for d3otra1:

Click to download the PDB-style file with coordinates for d3otra1.
(The format of our PDB-style files is described here.)

Timeline for d3otra1: