Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (19 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (476 PDB entries) |
Domain d3orxf_: 3orx F: [214509] automated match to d4eopc_ complexed with 1f8, cl; mutant |
PDB Entry: 3orx (more details), 2.2 Å
SCOPe Domain Sequences for d3orxf_:
Sequence, based on SEQRES records: (download)
>d3orxf_ d.144.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvm srldhpffvklyfcfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsale ylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspell teksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlve kllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt
>d3orxf_ d.144.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerdvm srldhpffvklyfcfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsale ylhgkgiihrdlkpenillnedmhiqitdfgtakvlsfvgtaqyvspellteksackssd lwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldatkr lgceemegygplkahpffesvtwenlhqqtppklt
Timeline for d3orxf_: