Lineage for d1fskf2 (1fsk F:119-220)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220885Species Anti-bet v1 Fab BV16, (mouse), kappa L chain [49106] (1 PDB entry)
  8. 220889Domain d1fskf2: 1fsk F:119-220 [21433]
    Other proteins in same PDB: d1fska_, d1fskb1, d1fskc1, d1fskd_, d1fske1, d1fskf1, d1fskg_, d1fskh1, d1fski1, d1fskj_, d1fskk1, d1fskl1

Details for d1fskf2

PDB Entry: 1fsk (more details), 2.9 Å

PDB Description: complex formation between a fab fragment of a monoclonal igg antibody and the major allergen from birch pollen bet v 1

SCOP Domain Sequences for d1fskf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fskf2 b.1.1.2 (F:119-220) Immunoglobulin (constant domains of L and H chains) {Anti-bet v1 Fab BV16, (mouse), kappa L chain}
akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1fskf2:

Click to download the PDB-style file with coordinates for d1fskf2.
(The format of our PDB-style files is described here.)

Timeline for d1fskf2: