Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Anti-bet v1 Fab BV16, (mouse), kappa L chain [49106] (1 PDB entry) |
Domain d1fskf2: 1fsk F:119-220 [21433] Other proteins in same PDB: d1fska_, d1fskb1, d1fskc1, d1fskd_, d1fske1, d1fskf1, d1fskg_, d1fskh1, d1fski1, d1fskj_, d1fskk1, d1fskl1 |
PDB Entry: 1fsk (more details), 2.9 Å
SCOP Domain Sequences for d1fskf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fskf2 b.1.1.2 (F:119-220) Immunoglobulin (constant domains of L and H chains) {Anti-bet v1 Fab BV16, (mouse), kappa L chain} akttppsvfplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
Timeline for d1fskf2: