Lineage for d3oced1 (3oce D:2-460)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010428Species Brucella melitensis [TaxId:359391] [225949] (2 PDB entries)
  8. 2010436Domain d3oced1: 3oce D:2-460 [214306]
    Other proteins in same PDB: d3ocea2, d3oceb2, d3ocec2, d3oced2
    automated match to d3r6vf_
    complexed with cl, co, edo

Details for d3oced1

PDB Entry: 3oce (more details), 2.58 Å

PDB Description: Crystal structure of fumarate lyase:delta crystallin from Brucella melitensis bound to cobalt
PDB Compounds: (D:) Fumarate lyase:Delta crystallin

SCOPe Domain Sequences for d3oced1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oced1 a.127.1.0 (D:2-460) automated matches {Brucella melitensis [TaxId: 359391]}
trreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatanyk
lrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlgrp
rgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefatvi
kigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlggtaigtrinashay
aeqaivelsqisgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgp
rsglgeirlpavqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafe
plivynilssmrllgramtnlaercvdgieanvercragaeesislatalvpvvgyaraa
eiakqalasgqtvmevaiskgldasaltimldplrmafp

SCOPe Domain Coordinates for d3oced1:

Click to download the PDB-style file with coordinates for d3oced1.
(The format of our PDB-style files is described here.)

Timeline for d3oced1: