![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
![]() | Superfamily a.127.1: L-aspartase-like [48557] (3 families) ![]() |
![]() | Family a.127.1.0: automated matches [191431] (1 protein) not a true family |
![]() | Protein automated matches [190621] (30 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:359391] [225949] (2 PDB entries) |
![]() | Domain d3ocea1: 3oce A:2-461 [214303] Other proteins in same PDB: d3ocea2, d3oceb2, d3ocec2, d3oced2 automated match to d3r6vf_ complexed with cl, co, edo |
PDB Entry: 3oce (more details), 2.58 Å
SCOPe Domain Sequences for d3ocea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ocea1 a.127.1.0 (A:2-461) automated matches {Brucella melitensis [TaxId: 359391]} trreqdslgerdipmdayfgiqtlravenfslsdvalnhipalvralamvkkaaatanyk lrqlpepkyaaivaacddiidgllmeqfvvdvfqggagtssnmnanevianralehlgrp rgdyqtihpnddvnmsqstndvyptavrlalllsqnqvqtalhrliaafeakgrefatvi kigrtqlqdavpitlgqefeafaatlredtarleevaalfrevnlggtaigtrinashay aeqaivelsqisgielkatgnlveaswdtgafvtfsgilrriavklskiandlrllssgp rsglgeirlpavqpgssimpgkvnpvipesvnqvcyqvigndltvtmaaesgqlqlnafe plivynilssmrllgramtnlaercvdgieanvercragaeesislatalvpvvgyaraa eiakqalasgqtvmevaiskgldasaltimldplrmafpp
Timeline for d3ocea1: