Lineage for d3o9vc2 (3o9v C:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)
  8. 2902368Domain d3o9vc2: 3o9v C:509-766 [214264]
    Other proteins in same PDB: d3o9va1, d3o9vb1, d3o9vb3, d3o9vc1, d3o9vd1
    automated match to d1orva2
    complexed with 10t, nag

Details for d3o9vc2

PDB Entry: 3o9v (more details), 2.75 Å

PDB Description: crystal structure of human dpp4 bound to tak-986
PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d3o9vc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9vc2 c.69.1.0 (C:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3o9vc2:

Click to download the PDB-style file with coordinates for d3o9vc2.
(The format of our PDB-style files is described here.)

Timeline for d3o9vc2: