| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries) |
| Domain d3o9va2: 3o9v A:509-766 [214260] Other proteins in same PDB: d3o9va1, d3o9vb1, d3o9vb3, d3o9vc1, d3o9vd1 automated match to d1orva2 complexed with 10t, nag |
PDB Entry: 3o9v (more details), 2.75 Å
SCOPe Domain Sequences for d3o9va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9va2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp
Timeline for d3o9va2: