SCOPe 2.08: Domain d1orva2: 1orv A:509-766

Lineage for d1orva2 (1orv A:509-766)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
N-terminal domain is a 8-bladed beta-propeller
automatically mapped to Pfam PF00326
Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries)
Domain d1orva2: 1orv A:509-766 [87355]
Other proteins in same PDB: d1orva1, d1orvb1, d1orvc1, d1orvd1
complexed with nag, so4

Details for d1orva2

PDB Entry: 1orv (more details), 1.8 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26)

PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1orva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orva2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

SCOPe Domain Coordinates for d1orva2:

Click to download the PDB-style file with coordinates for d1orva2.
(The format of our PDB-style files is described here.)

Timeline for d1orva2: