![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Kluyveromyces lactis [TaxId:28985] [225987] (8 PDB entries) |
![]() | Domain d3o6wa2: 3o6w A:224-485 [214217] automated match to d1ig8a2 complexed with gol, po4 |
PDB Entry: 3o6w (more details), 1.48 Å
SCOPe Domain Sequences for d3o6wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6wa2 c.55.1.0 (A:224-485) automated matches {Kluyveromyces lactis [TaxId: 28985]} qtkmgiiigtgvngayydvvsgieklegllpedigpdspmainceygsfdnehlvlprtk ydviideesprpgqqafekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdt sypskieddpfenledtddlfktnlniettvverklirklaelvgtraarltvcgvsaic dkrgyktahiaadgsvfnrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvga aiiacltqkrlaagksvgikge
Timeline for d3o6wa2: