Lineage for d3o6wb1 (3o6w B:20-223)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373524Species Kluyveromyces lactis [TaxId:28985] [225987] (8 PDB entries)
  8. 1373529Domain d3o6wb1: 3o6w B:20-223 [214218]
    automated match to d1ig8a1
    complexed with gol, po4

Details for d3o6wb1

PDB Entry: 3o6w (more details), 1.48 Å

PDB Description: crystal structure of monomeric klhxk1 in crystal form viii (open state)
PDB Compounds: (B:) hexokinase

SCOPe Domain Sequences for d3o6wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6wb1 c.55.1.0 (B:20-223) automated matches {Kluyveromyces lactis [TaxId: 28985]}
panlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmipgwvveyptgket
gdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseqlwsfiakclkefvd
ewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghdvvpmlqeqiekln
ipinvvalindttgtlvaslytdp

SCOPe Domain Coordinates for d3o6wb1:

Click to download the PDB-style file with coordinates for d3o6wb1.
(The format of our PDB-style files is described here.)

Timeline for d3o6wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o6wb2