Lineage for d1ig8a2 (1ig8 A:225-486)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) 
duplication contains two domains of this fold
Family c.55.1.3: Hexokinase [53083] (3 proteins) 
Protein Hexokinase [53084] (2 species) Species Baker's yeast (Saccharomyces cerevisiae), pII [TaxId:4932] [64092] (1 PDB entry) 
Domain d1ig8a2: 1ig8 A:225-486 [64747]
complexed with so4
Details for d1ig8a2
PDB Entry: 1ig8 (more details), 2.2 Å
PDB Description: Crystal Structure of Yeast Hexokinase PII with the correct amino acid sequence
PDB Compounds: (A:) hexokinase PIISCOPe Domain Sequences for d1ig8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]}
etkmgvifgtgvngayydvcsdieklqgklsddippsapmainceygsfdnehvvlprtk
yditideesprpgqqtfekmssgyylgeilrlalmdmykqgfifknqdlskfdkpfvmdt
syparieedpfenledtddlfqnefginttvqerklirrlseligaraarlsvcgiaaic
qkrgyktghiaadgsvynrypgfkekaanalkdiygwtqtslddypikivpaedgsgaga
aviaalaqkriaegksvgiiga
SCOPe Domain Coordinates for d1ig8a2:
Click to download the PDB-style file with coordinates for d1ig8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ig8a2:
- d1ig8a2 first appeared in SCOP 1.59
- d1ig8a2 appears in SCOPe 2.02
- d1ig8a2 appears in SCOPe 2.04
- d1ig8a2 appears in the current release, SCOPe 2.08
View in 3D
