Lineage for d3o5sa_ (3o5s A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1533532Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 1533583Protein automated matches [191047] (6 species)
    not a true protein
  7. 1533587Species Bacillus subtilis [TaxId:1423] [226170] (1 PDB entry)
  8. 1533588Domain d3o5sa_: 3o5s A: [214197]
    automated match to d1gbga_
    complexed with b3p, ca

Details for d3o5sa_

PDB Entry: 3o5s (more details), 2.2 Å

PDB Description: crystal structure of the endo-beta-1,3-1,4 glucanase from bacillus subtilis (strain 168)
PDB Compounds: (A:) Beta-glucanase

SCOPe Domain Sequences for d3o5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o5sa_ b.29.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tggsffdpfngynsgfwqkadgysngnmfnctwrannvsmtslgemrlaltspaynkfdc
genrsvqtygyglyevrmkpakntgivssfftytgptdgtpwdeidieflgkdttkvqfn
yytngagnhekivdlgfdaanayhtyafdwqpnsikwyvdgqlkhtatnqipttpgkimm
nlwngtgvdewlgsyngvnplyahydwvrytkk

SCOPe Domain Coordinates for d3o5sa_:

Click to download the PDB-style file with coordinates for d3o5sa_.
(The format of our PDB-style files is described here.)

Timeline for d3o5sa_: