| Class b: All beta proteins [48724] (174 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (6 proteins) Pfam PF00722 beta-Glucanase-like |
| Protein automated matches [191047] (6 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [226170] (1 PDB entry) |
| Domain d3o5sa_: 3o5s A: [214197] automated match to d1gbga_ complexed with b3p, ca |
PDB Entry: 3o5s (more details), 2.2 Å
SCOPe Domain Sequences for d3o5sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5sa_ b.29.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tggsffdpfngynsgfwqkadgysngnmfnctwrannvsmtslgemrlaltspaynkfdc
genrsvqtygyglyevrmkpakntgivssfftytgptdgtpwdeidieflgkdttkvqfn
yytngagnhekivdlgfdaanayhtyafdwqpnsikwyvdgqlkhtatnqipttpgkimm
nlwngtgvdewlgsyngvnplyahydwvrytkk
Timeline for d3o5sa_: