Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [49102] (3 PDB entries) |
Domain d1f4wl2: 1f4w L:111-210 [21416] Other proteins in same PDB: d1f4wh1, d1f4wl1 |
PDB Entry: 1f4w (more details), 2.3 Å
SCOP Domain Sequences for d1f4wl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4wl2 b.1.1.2 (L:111-210) Immunoglobulin (constant domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain} qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettnpskq snnkymassyltltarawerhssyscqvtheghtveksls
Timeline for d1f4wl2: