Lineage for d1f4wl1 (1f4w L:1-110)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157452Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [48898] (3 PDB entries)
  8. 157456Domain d1f4wl1: 1f4w L:1-110 [20452]
    Other proteins in same PDB: d1f4wh2, d1f4wl2

Details for d1f4wl1

PDB Entry: 1f4w (more details), 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4wl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4wl1 b.1.1.1 (L:1-110) Immunoglobulin (variable domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsstgtvttsnyanwvqekpdhlftgligatnnraagv
pvrfsgsliggkaaltitgaqtedeaiyfcalwysghwvfgggtkltvlg

SCOP Domain Coordinates for d1f4wl1:

Click to download the PDB-style file with coordinates for d1f4wl1.
(The format of our PDB-style files is described here.)

Timeline for d1f4wl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4wl2