Lineage for d3o08a2 (3o08 A:224-485)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606357Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [225987] (8 PDB entries)
  8. 1606373Domain d3o08a2: 3o08 A:224-485 [214099]
    automated match to d1ig8a2
    complexed with nhe, so4

Details for d3o08a2

PDB Entry: 3o08 (more details), 2 Å

PDB Description: crystal structure of dimeric klhxk1 in crystal form i
PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d3o08a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o08a2 c.55.1.0 (A:224-485) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
qtkmgiiigtgvngayydvvsgieklegllpedigpdspmainceygsfdnehlvlprtk
ydviideesprpgqqafekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdt
sypskieddpfenledtddlfktnlniettvverklirklaelvgtraarltvcgvsaic
dkrgyktahiaadgsvfnrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvga
aiiacltqkrlaagksvgikge

SCOPe Domain Coordinates for d3o08a2:

Click to download the PDB-style file with coordinates for d3o08a2.
(The format of our PDB-style files is described here.)

Timeline for d3o08a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o08a1