![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.3: Hexokinase [53083] (3 proteins) |
![]() | Protein Hexokinase [53084] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), pII [TaxId:4932] [64092] (1 PDB entry) |
![]() | Domain d1ig8a2: 1ig8 A:225-486 [64747] complexed with so4 |
PDB Entry: 1ig8 (more details), 2.2 Å
SCOPe Domain Sequences for d1ig8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} etkmgvifgtgvngayydvcsdieklqgklsddippsapmainceygsfdnehvvlprtk yditideesprpgqqtfekmssgyylgeilrlalmdmykqgfifknqdlskfdkpfvmdt syparieedpfenledtddlfqnefginttvqerklirrlseligaraarlsvcgiaaic qkrgyktghiaadgsvynrypgfkekaanalkdiygwtqtslddypikivpaedgsgaga aviaalaqkriaegksvgiiga
Timeline for d1ig8a2: