Lineage for d3ntga1 (3ntg A:18-58)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258485Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
    the rest of protein is heme-linked peroxidase, all-alpha fold
  7. 2258486Species Mouse (Mus musculus) [TaxId:10090] [57212] (12 PDB entries)
  8. 2258487Domain d3ntga1: 3ntg A:18-58 [214045]
    Other proteins in same PDB: d3ntga2, d3ntgb2, d3ntgc2, d3ntgd2
    automated match to d1ddxa2
    complexed with bog, d72, hem, nag

Details for d3ntga1

PDB Entry: 3ntg (more details), 2.19 Å

PDB Description: crystal structure of cox-2 with selective compound 23d-(r)
PDB Compounds: (A:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d3ntga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ntga1 g.3.11.1 (A:18-58) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

SCOPe Domain Coordinates for d3ntga1:

Click to download the PDB-style file with coordinates for d3ntga1.
(The format of our PDB-style files is described here.)

Timeline for d3ntga1: