SCOPe 2.06: Domain d3ntgb1: 3ntg B:18-58

Lineage for d3ntgb1 (3ntg B:18-58)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (12 PDB entries)

8. Domain d3ntgb1: 3ntg B:18-58 [214047]
   Other proteins in same PDB: d3ntga2, d3ntgb2, d3ntgc2, d3ntgd2
   automated match to d1ddxa2
   complexed with bog, d72, hem, nag

Details for d3ntgb1

PDB Entry: 3ntg, 2.19 Å

PDB Description: crystal structure of cox-2 with selective compound 23d-(r)

PDB Compounds: (B:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d3ntgb1:

Sequence; same for both SEQRES and ATOM records:

>d3ntgb1 g.3.11.1 (B:18-58) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d3ntgb1:

• d3ntgb1 first appeared in SCOPe 2.03
  
• d3ntgb1 appears in SCOPe 2.05
  
• d3ntgb1 appears in SCOPe 2.07
  
• d3ntgb1 appears in the current release, SCOPe 2.08