Lineage for d3notc3 (3not C:310-496)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576707Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2576804Family d.110.2.4: Phytochrome-specific domain [160664] (2 proteins)
    Pfam PF00360
  6. 2576805Protein Bacteriophytochrome BphP [160665] (1 species)
  7. 2576806Species Pseudomonas aeruginosa [TaxId:287] [160666] (4 PDB entries)
    Uniprot Q9HWR3 310-494
  8. 2576823Domain d3notc3: 3not C:310-496 [214027]
    Other proteins in same PDB: d3notc1, d3notc2
    automated match to d3c2wa2
    complexed with bla

Details for d3notc3

PDB Entry: 3not (more details), 2.7 Å

PDB Description: light-induced intermediate structure l2 of p. aeruginosa bacteriophytochrome
PDB Compounds: (C:) Bacteriophytochrome

SCOPe Domain Sequences for d3notc3:

Sequence, based on SEQRES records: (download)

>d3notc3 d.110.2.4 (C:310-496) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd
ferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqesgwifwfrh
eevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldl
melclnh

Sequence, based on observed residues (ATOM records): (download)

>d3notc3 d.110.2.4 (C:310-496) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd
ferqagnvlqrlqrdperdiyhtdnwgdccgvlairfhrqesgwifwfrheevhrirwgg
kpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelclnh

SCOPe Domain Coordinates for d3notc3:

Click to download the PDB-style file with coordinates for d3notc3.
(The format of our PDB-style files is described here.)

Timeline for d3notc3: