![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.4: Phytochrome-specific domain [160664] (2 proteins) Pfam PF00360 |
![]() | Protein Bacteriophytochrome BphP [160665] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [160666] (4 PDB entries) Uniprot Q9HWR3 310-494 |
![]() | Domain d3notc3: 3not C:310-496 [214027] Other proteins in same PDB: d3notc1, d3notc2 automated match to d3c2wa2 complexed with bla |
PDB Entry: 3not (more details), 2.7 Å
SCOPe Domain Sequences for d3notc3:
Sequence, based on SEQRES records: (download)
>d3notc3 d.110.2.4 (C:310-496) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd ferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqesgwifwfrh eevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldl melclnh
>d3notc3 d.110.2.4 (C:310-496) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]} riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd ferqagnvlqrlqrdperdiyhtdnwgdccgvlairfhrqesgwifwfrheevhrirwgg kpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelclnh
Timeline for d3notc3: