Lineage for d3na8c_ (3na8 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1573064Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1573065Protein automated matches [190115] (57 species)
    not a true protein
  7. 1573379Species Pseudomonas aeruginosa [TaxId:287] [226142] (2 PDB entries)
  8. 1573386Domain d3na8c_: 3na8 C: [213838]
    automated match to d2wnqa_
    complexed with mg, mlt

Details for d3na8c_

PDB Entry: 3na8 (more details), 1.85 Å

PDB Description: Crystal Structure of a putative dihydrodipicolinate synthetase from Pseudomonas aeruginosa
PDB Compounds: (C:) Putative dihydrodipicolinate synthetase

SCOPe Domain Sequences for d3na8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3na8c_ c.1.10.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
asihgiigytitpfaadggldlpalgrsierlidggvhaiaplgstgegaylsdpewdev
vdftlktvahrvptivsvsdlttaktvrraqfaeslgaeavmvlpisywklneaevfqhy
ravgeaigvpvmlynnpgtsgidmsvelilrivrevdnvtmvkestgdiqrmhklrllge
grvpfyngcnplaleafvagakgwcsaapnliptlngqlyqavldgdlekaralfyrqlp
lldfilrrglpttikaglglsglevgaprlpvqaldtegcrylqglleelr

SCOPe Domain Coordinates for d3na8c_:

Click to download the PDB-style file with coordinates for d3na8c_.
(The format of our PDB-style files is described here.)

Timeline for d3na8c_: