Lineage for d2wnqa_ (2wnq A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571860Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1571861Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1572356Protein automated matches [190095] (19 species)
    not a true protein
  7. 1572420Species Escherichia coli [TaxId:562] [189174] (6 PDB entries)
  8. 1572433Domain d2wnqa_: 2wnq A: [169482]
    automated match to d1hl2a_
    complexed with cl; mutant

Details for d2wnqa_

PDB Entry: 2wnq (more details), 1.8 Å

PDB Description: structure of the e192n mutant of e. coli n-acetylneuraminic acid lyase in space group p21
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d2wnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnqa_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hhhatnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslse
reqvleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeeh
cdhyraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqir
rehpdlvlyngydnifasgllagadggigstynimgwryqgivkalkegdiqtaqklqte
cnkvidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg

SCOPe Domain Coordinates for d2wnqa_:

Click to download the PDB-style file with coordinates for d2wnqa_.
(The format of our PDB-style files is described here.)

Timeline for d2wnqa_: