SCOPe 2.04: Domain d3n0gb2: 3n0g B:266-594

Lineage for d3n0gb2 (3n0g B:266-594)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (27 species)
   not a true protein

7. Species Populus tremula [TaxId:80863] [225928] (2 PDB entries)

8. Domain d3n0gb2: 3n0g B:266-594 [213672]
   Other proteins in same PDB: d3n0ga1, d3n0gb1
   automated match to d1hxga2
   complexed with dst, mg

Details for d3n0gb2

PDB Entry: 3n0g, 2.8 Å

PDB Description: crystal structure of isoprene synthase from grey poplar leaves (populus x canescens) in complex with three mg2+ ions and dimethylallyl-s-thiolodiphosphate

PDB Compounds: (B:) Isoprene synthase

SCOPe Domain Sequences for d3n0gb2:

Sequence; same for both SEQRES and ATOM records:

>d3n0gb2 a.128.1.0 (B:266-594) automated matches {Populus tremula [TaxId: 80863]}
nqvllelaildynmiqsvyqrdlretsrwwrrvglatklhfardrliesfywavgvafep
qysdcrnsvakmfsfvtiiddiydvygtldelelftdaverwdvnaindlpdymklcfla
lyntineiaydnlkdkgenilpyltkawadlcnaflqeakwlynkstptfddyfgnawks
ssgplqlifayfavvqnikkeeienlqkyhdiisrpshifrlcndlasasaeiargetan
svscymrtkgiseelatesvmnlidetwkkmnkeklggslfakpfvetainlarqshcty
hngdahtspdeltrkrvlsvitepilpfe

Timeline for d3n0gb2:

• d3n0gb2 first appeared in SCOPe 2.03
  
• d3n0gb2 appears in SCOPe 2.05
  
• d3n0gb2 appears in the current release, SCOPe 2.08