Lineage for d3n0gb2 (3n0g B:266-594)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2731994Species Populus tremula [TaxId:80863] [225928] (2 PDB entries)
  8. 2731998Domain d3n0gb2: 3n0g B:266-594 [213672]
    Other proteins in same PDB: d3n0ga1, d3n0gb1
    automated match to d1hxga2
    complexed with dst, mg

Details for d3n0gb2

PDB Entry: 3n0g (more details), 2.8 Å

PDB Description: crystal structure of isoprene synthase from grey poplar leaves (populus x canescens) in complex with three mg2+ ions and dimethylallyl-s-thiolodiphosphate
PDB Compounds: (B:) Isoprene synthase

SCOPe Domain Sequences for d3n0gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n0gb2 a.128.1.0 (B:266-594) automated matches {Populus tremula [TaxId: 80863]}
nqvllelaildynmiqsvyqrdlretsrwwrrvglatklhfardrliesfywavgvafep
qysdcrnsvakmfsfvtiiddiydvygtldelelftdaverwdvnaindlpdymklcfla
lyntineiaydnlkdkgenilpyltkawadlcnaflqeakwlynkstptfddyfgnawks
ssgplqlifayfavvqnikkeeienlqkyhdiisrpshifrlcndlasasaeiargetan
svscymrtkgiseelatesvmnlidetwkkmnkeklggslfakpfvetainlarqshcty
hngdahtspdeltrkrvlsvitepilpfe

SCOPe Domain Coordinates for d3n0gb2:

Click to download the PDB-style file with coordinates for d3n0gb2.
(The format of our PDB-style files is described here.)

Timeline for d3n0gb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n0gb1