![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Populus tremula [TaxId:80863] [225928] (2 PDB entries) |
![]() | Domain d3n0gb2: 3n0g B:266-594 [213672] Other proteins in same PDB: d3n0ga1, d3n0gb1 automated match to d1hxga2 complexed with dst, mg |
PDB Entry: 3n0g (more details), 2.8 Å
SCOPe Domain Sequences for d3n0gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n0gb2 a.128.1.0 (B:266-594) automated matches {Populus tremula [TaxId: 80863]} nqvllelaildynmiqsvyqrdlretsrwwrrvglatklhfardrliesfywavgvafep qysdcrnsvakmfsfvtiiddiydvygtldelelftdaverwdvnaindlpdymklcfla lyntineiaydnlkdkgenilpyltkawadlcnaflqeakwlynkstptfddyfgnawks ssgplqlifayfavvqnikkeeienlqkyhdiisrpshifrlcndlasasaeiargetan svscymrtkgiseelatesvmnlidetwkkmnkeklggslfakpfvetainlarqshcty hngdahtspdeltrkrvlsvitepilpfe
Timeline for d3n0gb2: