Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) duplication: contains two domains of this fold |
Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins) |
Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [160774] (8 PDB entries) Uniprot Q59110 123-196,262-366 |
Domain d3mm6b2: 3mm6 B:123-196,B:262-366 [213382] Other proteins in same PDB: d3mm6a1, d3mm6a2, d3mm6a3, d3mm6b1, d3mm6b3, d3mm6d1, d3mm6d2, d3mm6d3, d3mm6e1, d3mm6e3 automated match to d3mmcb3 complexed with cyn, sf4, srm |
PDB Entry: 3mm6 (more details), 1.9 Å
SCOPe Domain Sequences for d3mm6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mm6b2 d.134.1.1 (B:123-196,B:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]} kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw
Timeline for d3mm6b2: