SCOPe 2.03: Domain d3mm6b2: 3mm6 B:123-196,B:262-366

Lineage for d3mm6b2 (3mm6 B:123-196,B:262-366)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (1 family)
   duplication: contains two domains of this fold

5. Family d.134.1.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56015] (5 proteins)

6. Protein Dissimilatory sulfite reductase subunit beta, DsrB [160772] (2 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [160774] (8 PDB entries)
   Uniprot Q59110 123-196,262-366

8. Domain d3mm6b2: 3mm6 B:123-196,B:262-366 [213382]
   Other proteins in same PDB: d3mm6a1, d3mm6a2, d3mm6a3, d3mm6b1, d3mm6b3, d3mm6d1, d3mm6d2, d3mm6d3, d3mm6e1, d3mm6e3
   automated match to d3mmcb3
   complexed with cyn, sf4, srm

Details for d3mm6b2

PDB Entry: 3mm6, 1.9 Å

PDB Description: dissimilatory sulfite reductase cyanide complex

PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mm6b2:

Sequence; same for both SEQRES and ATOM records:

>d3mm6b2 d.134.1.1 (B:123-196,B:262-366) Dissimilatory sulfite reductase subunit beta, DsrB {Archaeoglobus fulgidus [TaxId: 2234]}
kgeyglsnivhtqgwihchtpaidasgivkavmdelyeyftdhklpamcrislaccanmc
gavhasdiaivgihXdgaaimvggklsearrmpelskvvvpwvpnepprwptlvkyvkqi
leawaanankherliewvdrigwerffeltgleftqhliddyritpyfysefrastqfkw

Timeline for d3mm6b2:

• d3mm6b2 is new in SCOPe 2.03-stable
  
• d3mm6b2 appears in SCOPe 2.04
  
• d3mm6b2 appears in the current release, SCOPe 2.08