SCOPe 2.08: Domain d3mj8l2: 3mj8 L:108-211

Lineage for d3mj8l2 (3mj8 L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)

8. Domain d3mj8l2: 3mj8 L:108-211 [213278]
   automated match to d1adql2

Details for d3mj8l2

PDB Entry: 3mj8, 2.94 Å

PDB Description: Crystal structure of HL4E10 Fab, a hamster Ab stimulatory for gammadelta T cells

PDB Compounds: (L:) stimulatory hamster antibody hl4e10 fab light chain

SCOPe Domain Sequences for d3mj8l2:

Sequence; same for both SEQRES and ATOM records:

>d3mj8l2 b.1.1.0 (L:108-211) automated matches {Cricetulus migratorius [TaxId: 10032]}
qpnaapsvtlfppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsks
dskymatsyltmtadawksrntfickvthggntvekslsp

Timeline for d3mj8l2:

• d3mj8l2 first appeared in SCOPe 2.03
  
• d3mj8l2 appears in SCOPe 2.07