Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries) |
Domain d3mj8a1: 3mj8 A:1-107 [213275] automated match to d1adql1 |
PDB Entry: 3mj8 (more details), 2.94 Å
SCOPe Domain Sequences for d3mj8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mj8a1 b.1.1.0 (A:1-107) automated matches {Cricetulus migratorius [TaxId: 10032]} sytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdh fsgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlg
Timeline for d3mj8a1:
View in 3D Domains from other chains: (mouse over for more information) d3mj8b_, d3mj8h_, d3mj8l1, d3mj8l2 |