Lineage for d3mj8a1 (3mj8 A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754215Species Cricetulus migratorius [TaxId:10032] [225940] (6 PDB entries)
  8. 2754236Domain d3mj8a1: 3mj8 A:1-107 [213275]
    automated match to d1adql1

Details for d3mj8a1

PDB Entry: 3mj8 (more details), 2.94 Å

PDB Description: Crystal structure of HL4E10 Fab, a hamster Ab stimulatory for gammadelta T cells
PDB Compounds: (A:) stimulatory hamster antibody hl4e10 fab light chain

SCOPe Domain Sequences for d3mj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mj8a1 b.1.1.0 (A:1-107) automated matches {Cricetulus migratorius [TaxId: 10032]}
sytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdh
fsgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlg

SCOPe Domain Coordinates for d3mj8a1:

Click to download the PDB-style file with coordinates for d3mj8a1.
(The format of our PDB-style files is described here.)

Timeline for d3mj8a1: