PDB entry 3mj8

View 3mj8 on RCSB PDB site
Description: Crystal structure of HL4E10 Fab, a hamster Ab stimulatory for gammadelta T cells
Class: immune system
Keywords: ANTIBODY, HAMSTER IgG, IMMUNE SYSTEM
Deposited on 2010-04-12, released 2011-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.23
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stimulatory hamster antibody hl4e10 fab light chain
    Species: CRICETULUS MIGRATORIUS [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJ8 (0-End)
    Domains in SCOPe 2.07: d3mj8a1, d3mj8a2
  • Chain 'B':
    Compound: stimulatory hamster antibody hl4e10 fab heavy chain
    Species: CRICETULUS MIGRATORIUS [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJ8 (0-End)
  • Chain 'H':
    Compound: stimulatory hamster antibody hl4e10 fab heavy chain
    Species: CRICETULUS MIGRATORIUS [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJ8 (0-End)
  • Chain 'L':
    Compound: stimulatory hamster antibody hl4e10 fab light chain
    Species: CRICETULUS MIGRATORIUS [TaxId:10032]
    Database cross-references and differences (RAF-indexed):
    • PDB 3MJ8 (0-End)
    Domains in SCOPe 2.07: d3mj8l1, d3mj8l2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3mj8A (A:)
    sytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdh
    fsgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlgqpnaapsvtlf
    ppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsksdskymatsylt
    mtadawksrntfickvthggntvekslspsacs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mj8A (A:)
    sytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdh
    fsgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlgqpnaapsvtlf
    ppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsksdskymatsylt
    mtadawksrntfickvthggntvekslsp
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3mj8L (L:)
    sytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdh
    fsgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlgqpnaapsvtlf
    ppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsksdskymatsylt
    mtadawksrntfickvthggntvekslspsacs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mj8L (L:)
    sytltqpplvsvalgqkatitcsgdklsdvyvhwyqqkagqapvlviyednrrpsgipdh
    fsgsnsgnmatltiskaqagdeadyycqswdgtnsawvfgsgtkvtvlgqpnaapsvtlf
    ppsseelktnqatlvcmingfypadvavtweadgtpitqgvkttqpsksdskymatsylt
    mtadawksrntfickvthggntvekslsp