Lineage for d3mgvb2 (3mgv B:130-341)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605773Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2605774Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2605775Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2605776Protein Cre recombinase [56355] (1 species)
  7. 2605777Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
    Uniprot P06956 20-341
  8. 2605782Domain d3mgvb2: 3mgv B:130-341 [213256]
    Other proteins in same PDB: d3mgva1, d3mgvb1, d3mgvc1, d3mgvd1
    automated match to d2crxa2
    protein/DNA complex; complexed with vo4

Details for d3mgvb2

PDB Entry: 3mgv (more details), 2.29 Å

PDB Description: Cre recombinase-DNA transition state
PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d3mgvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mgvb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOPe Domain Coordinates for d3mgvb2:

Click to download the PDB-style file with coordinates for d3mgvb2.
(The format of our PDB-style files is described here.)

Timeline for d3mgvb2: